PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK09859.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 370aa    MW: 41388.8 Da    PI: 7.5687
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK09859.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS340.23.5e-104336919374
       GRAS  19 laqalLarlselaspdgdpmqRlaayfteALaarlarsvs.elykal..ppsetsekn............sseelaalklfsevsPilkfshltaNqaIl 103
                 a+ lL++l+ +a   g+++qR+a++f+++La rla   + + +  +  +p + +               s+++  al+l +e+sP +kf+h++aN  Il
  PK09859.1   3 HASVLLSELRANALVFGSSFQRVASCFVQGLADRLAMVHPlGAVGFIalQPPQPP--PlpmmmnimdvgiSEKKEEALRLVYEISPHIKFGHFVANASIL 100
                7999********************************8433122222211333333..23456678888877777788899******************** PP

       GRAS 104 eavegeervHiiDfdis....qGlQWpaLlqaLasRp...egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                ea+ege+ vH++D++++    +G QW aL+q+La+R+   + p +lRiT+vg       e+ + +g+ L+ fA++l++++ef+v v ++le+l+ +++++
  PK09859.1 101 EAFEGESYVHVVDLGMTlglaHGEQWRALIQSLAQRAkthQLPKRLRITAVGL----CVERFQIIGDELELFANSLNLNLEFTV-VKSNLENLTSKDIKT 195
                *************98652233889************96644478*********....**************************9.799************ PP

       GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                +++E++aVn+vlqlh +++es    +   +vL+++ +l+Pkv+v+veq+++hn++ Fl rf+eal+yysa+fdsl+a lp+ +  r+k+E++++++ei+n
  PK09859.1 196 SKDEVIAVNSVLQLHCVVKESRGALN---SVLQTIHELNPKVLVLVEQDSSHNGPFFLGRFMEALHYYSAIFDSLDAMLPKYDTRRAKIEQFYFAEEIKN 292
                ******************88877777...8********************************************************************** PP

       GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                +++ceg +r+erhe++ +Wr+r+++aGF++ p++  +  +ak  l +++  +gy+v ee+g+lvlgWk+rp+v++S+W+
  PK09859.1 293 IISCEGPARVERHERVDQWRRRMSRAGFQAGPIK--MLGSAKQWLGQIEaCEGYTVVEEKGCLVLGWKSRPIVAASCWK 369
                ********************************96..678899999999999***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.0111350IPR005202Transcription factor GRAS
PfamPF035141.2E-1013369IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
XSHASVLLSE LRANALVFGS SFQRVASCFV QGLADRLAMV HPLGAVGFIA LQPPQPPPLP  60
MMMNIMDVGI SEKKEEALRL VYEISPHIKF GHFVANASIL EAFEGESYVH VVDLGMTLGL  120
AHGEQWRALI QSLAQRAKTH QLPKRLRITA VGLCVERFQI IGDELELFAN SLNLNLEFTV  180
VKSNLENLTS KDIKTSKDEV IAVNSVLQLH CVVKESRGAL NSVLQTIHEL NPKVLVLVEQ  240
DSSHNGPFFL GRFMEALHYY SAIFDSLDAM LPKYDTRRAK IEQFYFAEEI KNIISCEGPA  300
RVERHERVDQ WRRRMSRAGF QAGPIKMLGS AKQWLGQIEA CEGYTVVEEK GCLVLGWKSR  360
PIVAASCWKC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-41436922375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4275321e-33AM427532.2 Vitis vinifera contig VV78X081155.6, whole genome shotgun sequence.
GenBankAM4892521e-33AM489252.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X112781.14, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015882278.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A067K4B20.0A0A067K4B2_JATCU; GRAS32 protein
STRINGPOPTR_0012s09550.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87302945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.18e-70RGA-like 1